PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0354s0230.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 308aa    MW: 35198.8 Da    PI: 7.8664
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0354s0230.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.8e-51231511128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             + pGfrFhPtdeelv +yL++kve+k+l++ e ik++diyk++PwdLpk  + ++kewyfF+ r +ky+++ r+nr+t sg+Wkatg
  SapurV1A.0354s0230.1.p  23 MLPGFRFHPTDEELVGFYLRRKVEKKPLSI-ELIKQIDIYKYDPWDLPKVSNVGDKEWYFFCIRGRKYRNSIRPNRVTGSGFWKATG 108
                             579***************************.89***************888889********************************* PP

                     NAM  88 kdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              dk+v+s   ++e +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  SapurV1A.0354s0230.1.p 109 IDKPVYSVkeTHECIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 151
                             ******98555566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-5618180IPR003441NAC domain
PROSITE profilePS5100553.69723181IPR003441NAC domain
PfamPF023651.8E-2525151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEALSKMRGS DDMDHNNKDE EVMLPGFRFH PTDEELVGFY LRRKVEKKPL SIELIKQIDI  60
YKYDPWDLPK VSNVGDKEWY FFCIRGRKYR NSIRPNRVTG SGFWKATGID KPVYSVKETH  120
ECIGLKKSLV YYRGSAGKGT KTDWMMHEFR LPPNGKTTNP LNPKNIALEA EVWTLCRIIK  180
RVPSYKKYVA PAVAAAKQSP VKDSNSKTCS FESETSAEQN ASFGEYSFVQ RNERKPVIID  240
QVNHERTQFL TGGQYDSITD APFTAAFQNF WNTDVGDDFL ANGNWDELIT VVEPGVIDPA  300
QVYDYCK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-482518722174NAC domain-containing protein 19
3swp_C5e-482518722174NAC domain-containing protein 19
3swp_B5e-482518722174NAC domain-containing protein 19
3swp_A5e-482518722174NAC domain-containing protein 19
3swm_D5e-482518722174NAC domain-containing protein 19
3swm_C5e-482518722174NAC domain-containing protein 19
3swm_B5e-482518722174NAC domain-containing protein 19
3swm_A5e-482518722174NAC domain-containing protein 19
4dul_B6e-482518719171NAC domain-containing protein 19
4dul_A6e-482518719171NAC domain-containing protein 19
1ut7_B6e-482518719171NO APICAL MERISTEM PROTEIN
1ut7_A6e-482518719171NO APICAL MERISTEM PROTEIN
1ut4_B6e-482518719171NO APICAL MERISTEM PROTEIN
1ut4_A6e-482518719171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4504374e-64AM450437.2 Vitis vinifera contig VV78X104935.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011026224.10.0PREDICTED: transcription factor JUNGBRUNNEN 1 isoform X1
SwissprotQ9SK552e-97NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLB9GT110.0B9GT11_POPTR; Uncharacterized protein
STRINGPOPTR_0002s05820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-96NAC domain containing protein 42